PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g070110.1
Common NameMTR_3g070110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 217aa    MW: 24889.5 Da    PI: 4.991
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g070110.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.61.2e-0797140447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      W+ +E+ +++++      g Wk I++   k++t+ q+ s+ qky
  Medtr3g070110.1  97 WSCDEHMRFLKGLVDGKDGKWKEISKDYVKTKTPPQVASHAQKY 140
                      9***********99999999***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.94289145IPR017930Myb domain
SuperFamilySSF466891.61E-1092145IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-1092143IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MVENSLGYSL HGMMNDFQED DYWLMKETML CSVDQINQHN IDEVVLDDNI ASTSVSLFGY  60
DSVDSFNFSP HATDSNNNRT TNIVESKKKS FKKVVHWSCD EHMRFLKGLV DGKDGKWKEI  120
SKDYVKTKTP PQVASHAQKY EKRQKQRLDD DSKNMKRKLR ASIHDITTLD LLGSDDSYAW  180
FFGDQVIEDD NNNNRSLSVT TFNQECDQDH EVVAST*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141158KRQKQRLDDDSKNMKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT9610560.0CT961056.6 M.truncatula DNA sequence from clone MTH2-16N8 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003600854.21e-161MYB-like DNA-binding domain, shaqkyf class protein
TrEMBLG7JAP11e-161G7JAP1_MEDTR; MYB-like DNA-binding domain, shaqkyf class protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3898622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05790.17e-19MYB family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]